The domain within your query sequence starts at position 232 and ends at position 284; the E-value for the EBP50_C domain shown below is 5.1e-13.

TDEHFKRLRVIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDN

EBP50_C

 EBP50_C
PFAM accession number:PF09007
Interpro abstract (IPR015098):

This C-terminal domain allows interaction of EBP50 with FERM (four-point one ERM) domains, resulting in the activation of Ezrin-radixin-moesin (ERM), with subsequent cytoskeletal modulation and cellular growth control [ (PUBMED:15020681) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EBP50_C