The domain within your query sequence starts at position 26 and ends at position 63; the E-value for the ECR1_N domain shown below is 2.5e-19.

LVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERV

ECR1_N

ECR1_N
PFAM accession number:PF14382
Interpro abstract (IPR025721):

This entry represents a domain found in the N-terminal region of some exosome complex components, including ribosomal RNA-processing protein 4 (RRP4) and CSL4. It is a G-rich domain which structurally is a rudimentary single hybrid fold with a permuted topology.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECR1_N