The domain within your query sequence starts at position 26 and ends at position 64; the E-value for the ECR1_N domain shown below is 1.4e-18.
LVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVN
ECR1_N |
![]() |
---|
PFAM accession number: | PF14382 |
---|---|
Interpro abstract (IPR025721): | This entry represents a domain found in the N-terminal region of some exosome complex components, including ribosomal RNA-processing protein 4 (RRP4) and CSL4. It is a G-rich domain which structurally is a rudimentary single hybrid fold with a permuted topology. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECR1_N