The domain within your query sequence starts at position 83 and ends at position 156; the E-value for the ECSCR domain shown below is 2.8e-40.

TKKMTILLTILPTPTSESVLTVAAFGVISFIVILVVVVIILVSVVSLRFKCRKNKESEDP
QKPGSSGLSERVFW

ECSCR

ECSCR
PFAM accession number:PF15820
Interpro abstract (IPR026247):

Endothelial cell-specific chemotaxis regulator, ECSCR (also known as endothelial cell-specific molecule 2, ECMS2), is a novel cell surface protein that regulates endothelial chemotaxis and tube formation; it also interacts with filamin A, implicating a role in angiogenesis via modulation of the actin cytoskeleton [ (PUBMED:18556573) ].

ECSCR is a 205-amino acid protein containing a putative transmembrane (TM) domain, a conserved intracellular domain and a variable extracellular domain, but no other known functional sites, and no similarity to any other known proteins. It has been shown that the protein is a marker of primary hemangioblasts and endothelial progenitors, and not other hematopoietic progenitor cells [ (PUBMED:12384418) ], but little else is known about the protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ECSCR