SMART: Pfam domain EF-hand

The domain within your query sequence starts at position 197 and ends at position 246; the E-value for the EF-hand_10 domain shown below is 1.8e-27.

KMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIEAFLRRL

EF-hand_10

PFAM accession number:	PF14788
Interpro abstract (IPR039504):	PLC-delta-3 is essential for trophoblast and placental development [ (PUBMED:16314520) ]. It locates at the cleavage furrow where it may participate in cytokinesis [ (PUBMED:17041247) ]. PI-PLC-delta3 contains a core set of domains, including an N-terminal pleckstrin homology (PH) domain, four atypical EF-hand motifs, a PLC catalytic core, and a single C-terminal C2 domain. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. In addition, PI-PLC-delta3 possesses a classical leucine-rich nuclear export sequence (NES) located in the EF hand motifs, which may be responsible transporting PI-PLC-delta3 from the cell nucleus [ (PUBMED:9062102) ]. This entry represents the EF-hand domain found in 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 (PLC-delta3).

PFAM accession number:

PF14788

Interpro abstract (IPR039504):

PLC-delta-3 is essential for trophoblast and placental development [ (PUBMED:16314520) ]. It locates at the cleavage furrow where it may participate in cytokinesis [ (PUBMED:17041247) ].

PI-PLC-delta3 contains a core set of domains, including an N-terminal pleckstrin homology (PH) domain, four atypical EF-hand motifs, a PLC catalytic core, and a single C-terminal C2 domain. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. In addition, PI-PLC-delta3 possesses a classical leucine-rich nuclear export sequence (NES) located in the EF hand motifs, which may be responsible transporting PI-PLC-delta3 from the cell nucleus [ (PUBMED:9062102) ].

This entry represents the EF-hand domain found in 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 (PLC-delta3).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_10