The domain within your query sequence starts at position 317 and ends at position 399; the E-value for the EF-hand_like domain shown below is 1.7e-26.

DLYLLMLTYSNHKDHLDASDLQRFLEVEQKMNGVTLESCQNIIEQFEPCLENKSKGMLGI
DGFTNYTRSPAGDIFNPEHNRVH

EF-hand_like

EF-hand_like
PFAM accession number:PF09279
Interpro abstract (IPR015359):

This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C. It adopts a structure consisting of a core of four alpha helices, in an EF like fold, and is required for functioning of the enzyme [ (PUBMED:8784353) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF-hand_like