The domain within your query sequence starts at position 369 and ends at position 454; the E-value for the EFG_C domain shown below is 1e-16.
WRLGFLGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSAKLIKARRAIQKNMTFIDE NRVMLKYLFPLNEIVVDFYDSLKSLS
EFG_C |
![]() |
---|
PFAM accession number: | PF00679 |
---|---|
Interpro abstract (IPR000640): | Elongation factor 2 (EF2 or EFG) is folded into five domains, with domains I and II forming the N-terminal block, domains IV and V forming the C-terminal block, and domain III providing the covalently-linked flexible connection between the two [ (PUBMED:11054294) ]. This entry represents the domain V of EF2 of both prokaryotes and eukaryotes (also known as eEF2). This domain is also found in elongation factor 4 and some tetracycline resistance proteins and adopts a ferredoxin-like fold [ (PUBMED:12471894) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EFG_C