The domain within your query sequence starts at position 353 and ends at position 427; the E-value for the EF_assoc_1 domain shown below is 1.8e-33.
PWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAI TVTRDKKIDLQKKQT
EF_assoc_1 |
 |
|---|
| PFAM accession number: | PF08355 |
|---|---|
| Interpro abstract (IPR013566): | This region typically appears on the C terminus of EF hands in GTP-binding proteins such as Arht/Rhot (may be involved in mitochondrial homeostasis and apoptosis[ (PUBMED:15218247) ]). The EF hand associated region is found in yeast, vertebrates and plants. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EF_assoc_1