The domain within your query sequence starts at position 15 and ends at position 123; the E-value for the ELL domain shown below is 2e-13.
LFTPAARTSLLMLRLNEAALRALQECQQQQVRPVIAFQGHRGYLRFPGPGWSCLFSFIVS QCGQEGTNGGLDLVYQRLGRSGPNCLHCLGSLRERLTIWAAMDTIPAPL
ELL |
---|
PFAM accession number: | PF10390 |
---|---|
Interpro abstract (IPR019464): | This entry represents the N-terminal domain of EEL. ELL is a family of RNA polymerase II elongation factors. It is bound stably to elongation-associated factors 1 and 2, EAFs, and together these act as a strong regulator of transcription activity. by direct interaction with Pol II. ELL binds to pol II on its own but the affinity is greatly increased by the cooperation of EAF [ (PUBMED:17150956) ]. Some members carry an occludin domain ( IPR010844 ) just downstream. There is no Saccharomyces cerevisiae (Baker's yeast) member. |
GO process: | transcription elongation from RNA polymerase II promoter (GO:0006368) |
GO component: | transcription elongation factor complex (GO:0008023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELL