The domain within your query sequence starts at position 6 and ends at position 289; the E-value for the ELL domain shown below is 2.2e-107.

EARSYGLSCGRVSDGSRVSVFHVKLTDSALKAFESYRAHQDSVSLRPSIRFEGSQGHISI
PQPDCPEEVRAFSFYLSNIGRDSPQGSFDCIQQYVSSYGDVHLDCLGSIQDKVTVCATDD
SYQKARQSMAQAEEETRSRSAIVIKAGGRYMGKKVQFRKPAPGAADAVPSRKRATPINLA
SAIRKSSGSGASSVVQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKDTLDSLLQQ
VASVNPKDGTCTLQDCMYKSLQKDWPGYSEGDRQLLKRMLMRKL

ELL

 ELL
PFAM accession number:PF10390
Interpro abstract (IPR019464):

This entry represents the N-terminal domain of EEL.

ELL is a family of RNA polymerase II elongation factors. It is bound stably to elongation-associated factors 1 and 2, EAFs, and together these act as a strong regulator of transcription activity. by direct interaction with Pol II. ELL binds to pol II on its own but the affinity is greatly increased by the cooperation of EAF [ (PUBMED:17150956) ]. Some members carry an occludin domain ( IPR010844 ) just downstream. There is no Saccharomyces cerevisiae (Baker's yeast) member.

GO process:transcription elongation from RNA polymerase II promoter (GO:0006368)
GO component:transcription elongation factor complex (GO:0008023)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ELL