SMART: Pfam domain EMP24

The domain within your query sequence starts at position 35 and ends at position 96; the E-value for the EMP24_GP25L domain shown below is 2.4e-14.

DFTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKSDGV
HT

EMP24_GP25L

PFAM accession number:	PF01105
Interpro abstract (IPR009038):	The GOLD (for Golgi dynamics) domain is a protein module found in several eukaryotic Golgi and lipid-traffic proteins. It is typically between 90 and 150 amino acids long. Most of the size difference observed in the GOLD-domain superfamily is traceable to a single large low-complexity insert that is seen in some versions of the domain. With the exception of the p24 proteins, which have a simple architecture with the GOLD domain as their only globular domain, all other GOLD-domain proteins contain additional conserved globular domains. In these proteins, the GOLD domain co-occurs with lipid-, sterol- or fatty acid-binding domains such as PH, CRAL-TRIO, FYVE oxysterol binding- and acyl CoA-binding domains, suggesting that these proteins may interact with membranes. The GOLD domain can also be found associated with a RUN domain, which may have a role in the interaction of various proteins with cytoskeletal filaments. The GOLD domain is predicted to mediate diverse protein-protein interactions [ (PUBMED:12049664) ]. A secondary structure prediction for the GOLD domain reveals that it is likely to adopt a compact all-beta-fold structure with six to seven strands. Most of the sequence conservation is centred on the hydrophobic cores that support these predicted strands. The predicted secondary-structure elements and the size of the conserved core of the domain suggests that it may form a beta- sandwich fold with the strands arranged in two beta sheets stacked on each other [ (PUBMED:12049664) ]. Some proteins known to contain a GOLD domain are listed below: Eukaryotic proteins of the p24 family. Animal Sec14-like proteins. They are involved in secretion. Human Golgi resident protein GCP60. It interacts with the Golgi integral membrane protein Giantin. Yeast oxysterol-binding protein homologue 3 (OSH3).

PFAM accession number:

PF01105

Interpro abstract (IPR009038):

The GOLD (for Golgi dynamics) domain is a protein module found in several eukaryotic Golgi and lipid-traffic proteins. It is typically between 90 and 150 amino acids long. Most of the size difference observed in the GOLD-domain superfamily is traceable to a single large low-complexity insert that is seen in some versions of the domain. With the exception of the p24 proteins, which have a simple architecture with the GOLD domain as their only globular domain, all other GOLD-domain proteins contain additional conserved globular domains. In these proteins, the GOLD domain co-occurs with lipid-, sterol- or fatty acid-binding domains such as PH, CRAL-TRIO, FYVE oxysterol binding- and acyl CoA-binding domains, suggesting that these proteins may interact with membranes. The GOLD domain can also be found associated with a RUN domain, which may have a role in the interaction of various proteins with cytoskeletal filaments. The GOLD domain is predicted to mediate diverse protein-protein interactions [ (PUBMED:12049664) ]. A secondary structure prediction for the GOLD domain reveals that it is likely to adopt a compact all-beta-fold structure with six to seven strands. Most of the sequence conservation is centred on the hydrophobic cores that support these predicted strands. The predicted secondary-structure elements and the size of the conserved core of the domain suggests that it may form a beta- sandwich fold with the strands arranged in two beta sheets stacked on each other [ (PUBMED:12049664) ].

Some proteins known to contain a GOLD domain are listed below:

Eukaryotic proteins of the p24 family.
Animal Sec14-like proteins. They are involved in secretion.
Human Golgi resident protein GCP60. It interacts with the Golgi integral membrane protein Giantin.
Yeast oxysterol-binding protein homologue 3 (OSH3).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EMP24_GP25L