The domain within your query sequence starts at position 73 and ends at position 112; the E-value for the EMP70 domain shown below is 5.9e-9.
LPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKEE
EMP70 |
---|
PFAM accession number: | PF02990 |
---|---|
Interpro abstract (IPR004240): | The transmembrane 9 superfamily protein (TM9SF) may function as a channel or small molecule transporter. Proteins in this group are endosomal integral membrane proteins. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EMP70