The domain within your query sequence starts at position 363 and ends at position 405; the E-value for the EPTP domain shown below is 2.4e-9.
GFYSHQALHAWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWS
EPTP |
![]() |
---|
PFAM accession number: | PF03736 |
---|---|
Interpro abstract (IPR005492): | Mutations in the LGI/EPT gene can result in a special form of epilepsy, autosomal dominant lateral temporal epilepsy. The Epitempin protein (also known as Leucine-rich glioma-inactivated protein) was seen to contain a 130 amino acid repeat in its C-terminal section, although a sub-domain of 50 amino acids has now been further defined within this. The architecture and structural features of this repeat make it a likely member 7-bladed beta-propeller fold [ (PUBMED:12095917) ]. This protein has now been found in a number of proteins associated with neurological disorders suggesting that it may play a role in the development of epilepsy and other related conditions [ (PUBMED:12217514) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EPTP