The domain within your query sequence starts at position 579 and ends at position 632; the E-value for the ERAP1_C domain shown below is 5.6e-10.

WVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLLHKQAD

ERAP1_C

 ERAP1_C
PFAM accession number:PF11838
Interpro abstract (IPR024571):

This large domain is composed of 16 alpha helices organised as 8 HEAT-like repeats. This domain forms a concave face that faces towards the active site of the peptidase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERAP1_C