The domain within your query sequence starts at position 7 and ends at position 121; the E-value for the ERG2_Sigma1R domain shown below is 9.2e-46.
RRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELR RLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGETV
ERG2_Sigma1R |
---|
PFAM accession number: | PF04622 |
---|---|
Interpro abstract (IPR006716): | This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols [ (PUBMED:8082205) ]. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [ (PUBMED:8755605) ], which interacts with endogenous steroid hormones, such as progesterone and testosterone [ (PUBMED:9425306) ]. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine [ (PUBMED:8755605) ]. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERG2_Sigma1R