The domain within your query sequence starts at position 23 and ends at position 223; the E-value for the ERK-JNK_inhib domain shown below is 1.7e-71.
ALKSTLDPSLKIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRT VLIAADVLPDGPVPQDEKLKDAFSHVVENTAFFGDVVLRFPKIVHHYFDHNSNWNLLIRW GISFCNQTGVFDQGPHSPILSLMAQELGITEKDSDFRNPFKTDQTEFIPSTDPFQKALRE EEKRRKKEERRKEIRKGPRIS
ERK-JNK_inhib |
![]() |
---|
PFAM accession number: | PF15002 |
---|---|
Interpro abstract (IPR026321): | This coiled-coil domain-containing protein 134 (CCDC134) is a secretory protein that regulates the mitogen activated protein kinase (MAPK) pathway [ (PUBMED:18087676) ]. Overexpression of CCDC134 inhibits transcriptional activity of Elk1 and phosphorylation of Erk and JNK/SAPK but not p38 MAPK [ (PUBMED:18087676) ]. In humans, CCDC134 interacts with a transcription adaptor hADA2a [ (PUBMED:22644376) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ERK-JNK_inhib