The domain within your query sequence starts at position 10 and ends at position 153; the E-value for the ESCRT-II domain shown below is 7.2e-56.
QYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRHS LNLKPGKLPVESIQIVLEELRKKGNLEWLDKNKSSFLIMWRRPEEWGKLIYQWVSRSGQN NSVFTLYELTSGEDTEDEEFHGLD
ESCRT-II |
 |
|---|
| PFAM accession number: | PF05871 |
|---|---|
| Interpro abstract (IPR008570): | This entry represents the Vps25 subunit (vacuolar protein sorting-associated protein 25) of the endosome-associated complex ESCRT-II (Endosomal Sorting Complexes Required for Transport protein II). ESCRT (ESCRT-I, -II, -III) complexes orchestrate efficient sorting of ubiquitinated transmembrane receptors to lysosomes via multivesicular bodies (MVBs) [ (PUBMED:17215868) ]. ESCRT-II recruits the transport machinery for protein sorting at MVB [ (PUBMED:15469844) ]. In addition, the human ESCRT-II has been shown to form a complex with RNA polymerase II elongation factor ELL in order to exert transcriptional control activity. ESCRT-II transiently associates with the endosomal membrane and thereby initiates the formation of ESCRT-III, a membrane-associated protein complex that functions immediately downstream of ESCRT-II during sorting of MVB cargo. ESCRT-II in turn functions downstream of ESCRT-I, a protein complex that binds to ubiquitinated endosomal cargo [ (PUBMED:12194858) ]. ESCRT-II is a trilobal complex composed of two copies of vps25, one copy of vps22 and the C-terminal region of vps36. The crystal structure of vps25 revealed two winged-helix domains, the N-terminal domain of vps25 interacting with vps22 and vps35 [ (PUBMED:15579210) ]. |
| GO process: | multivesicular body sorting pathway (GO:0071985) |
| GO component: | ESCRT II complex (GO:0000814) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ESCRT-II