The domain within your query sequence starts at position 19 and ends at position 130; the E-value for the ESSS domain shown below is 6.9e-40.
LQAAPLCWKSSSSRAVVARSAAARKEQEEPTVQWMEDPDPEDENVYLKNPHFHGYDDDPK VDALNMHAVFFFGFSIALVLGTTFVAYVPNYKMIEWARREAAMLVKHREASG
ESSS |
---|
PFAM accession number: | PF10183 |
---|---|
Interpro abstract (IPR019329): | This entry represents the ESSS subunit from mitochondrial NADH:ubiquinone oxidoreductase (complex I). It carries mitochondrial import sequences [ (PUBMED:12381726) ]. NADH:ubiquinone oxidoreductase (complex I) ( EC 1.6.5.3 ) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) [ (PUBMED:1470679) ]. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [ (PUBMED:10940377) ], mitochondria, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins [ (PUBMED:18394423) ]. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 45 subunits, one FMN co-factor and eight FeS clusters [ (PUBMED:18563446) ]. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [ (PUBMED:18563446) (PUBMED:17854760) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ESSS