The domain within your query sequence starts at position 63 and ends at position 177; the E-value for the EST1 domain shown below is 3.4e-30.
KVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFN VDLPCRVKSSQLGIISNKQTHSSTIVKPQSSSCSYICQHCLVHLGDIARYRNQTS
EST1 |
---|
PFAM accession number: | PF10374 |
---|---|
Interpro abstract (IPR019458): | Est1 is directly involved in telomere replication. It associates with telomerase and, during its interaction with CDC13, telomerase activity is promoted [ (PUBMED:12169735) (PUBMED:12454059) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EST1