The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the ETS_PEA3_N domain shown below is 9.3e-29.
XVPAAPPPLQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCADSEVPNCQS SYMRGGYFSSSHEGCSPLGYPEESA
ETS_PEA3_N |
---|
PFAM accession number: | PF04621 |
---|---|
Interpro abstract (IPR006715): | The N-terminal of the PEA3 transcription factors is implicated in transactivation and in inhibition of DNA binding [ (PUBMED:9259977) ]. Transactivation is potentiated by activation of the Ras/MAP kinase and protein kinase A signalling cascades. The N-terminal region contains conserved MAP kinase phosphorylation sites [ (PUBMED:9285689) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ETS_PEA3_N