The domain within your query sequence starts at position 1 and ends at position 94; the E-value for the ETS_PEA3_N domain shown below is 3.3e-55.

MDGFCDQQVPFMVPGKSRSEDCRGRPLIDRKRKFVDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHS

ETS_PEA3_N

ETS_PEA3_N
PFAM accession number:PF04621
Interpro abstract (IPR006715):

The N-terminal of the PEA3 transcription factors is implicated in transactivation and in inhibition of DNA binding [ (PUBMED:9259977) ]. Transactivation is potentiated by activation of the Ras/MAP kinase and protein kinase A signalling cascades. The N-terminal region contains conserved MAP kinase phosphorylation sites [ (PUBMED:9285689) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:DNA-binding transcription factor activity (GO:0003700)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ETS_PEA3_N