The domain within your query sequence starts at position 34 and ends at position 114; the E-value for the Eaf7 domain shown below is 2.2e-27.
EVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHES EILPFPNPERNFVLPDEIIQE
Eaf7 |
 |
|---|
| PFAM accession number: | PF07904 |
|---|---|
| Interpro abstract (IPR012423): | This entry includes fungal chromatin modification-related protein Eaf7 and its mammalian homologue, MRG/MORF4L-binding protein (MRGBP). Eaf7/MRGBP is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A [ (PUBMED:15353583) ]. |
| GO process: | regulation of transcription, DNA-templated (GO:0006355) |
| GO component: | H4/H2A histone acetyltransferase complex (GO:0043189), nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Eaf7