The domain within your query sequence starts at position 136 and ends at position 279; the E-value for the Eapp_C domain shown below is 5e-54.
LYDPEKDNRDQAWVDAKRRGYHAFGLQRPRQKQQPVPNSDAVLNCPACMTTLCLDCQRHE SYKTQYRAMFVMNCSINREEVLRYKNPENRRKRRSAKKMRSNPEDPAEREAEEIYHPVMC TECSTEVAVYDKDEVFHFFNVLAS
Eapp_C |
---|
PFAM accession number: | PF10238 |
---|---|
Interpro abstract (IPR019370): | This entry represents E2F binding proteins. E2F transcription factors play an essential role in cell proliferation and apoptosis and their activity is frequently deregulated in human cancers. E2F activity is regulated by a variety of mechanisms, frequently mediated by proteins binding to individual members or a subgroup of the family. E2F-associated phosphoprotein (EAPP)interacts with a subset of E2F factors and influences E2F-dependent promoter activity. EAPP is present throughout the cell cycle but disappears during mitosis [ (PUBMED:15716352) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Eapp_C