The domain within your query sequence starts at position 58 and ends at position 211; the E-value for the EcKinase domain shown below is 1.8e-8.

GPEHIREPQLFRLIALEMAKIHTIHANGSLPKPTLWHKMHRYFTLVKDEISPSLSADVPK
VEVLEQELAWLKEHLSQLDSPVVFCHNDLLCKNIIYDSDKGRVCFIDYEYAGYNYQAFDI
GNHFNEFAGVNVVDYSRYPARETQVQWLRYYLEA

EcKinase

 EcKinase
PFAM accession number:PF02958
Interpro abstract (IPR004119):

This family includes ecdysteroid 22-kinase, an enzyme responsible for the phosphorylation of ecdysteroids (insect growth and moulting hormones) at C-22, to form physiologically inactive ecdysteroid 22-phosphates [ (PUBMED:16899460) ]. Most insects contain 12 to 105 genes encoding this family and yet so far only one enzyme (ecdysteroid 22-kinase from Bombyx mori) has characterised substrates (2-deoxyecdysone, ecdysone, 20-hydroxyecdysone). There are good reasons to believe that this family includes kinases that act on other small molecule substrates and that they may function in detoxification processes [ (PUBMED:32540344) ].

This family also includes 4-hydroxytryptamine kinase, a psilocybin biosynthesis kinase from fungi [ (PUBMED:28763571) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry EcKinase