The domain within your query sequence starts at position 11 and ends at position 48; the E-value for the Elf-1_N domain shown below is 4.9e-11.

NQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHMESP

Elf-1_N

Elf-1_N
PFAM accession number:PF12310
Interpro abstract (IPR022084):

Elf (E74-like-factor) is a subfamily of the ETS transcription factor family [ (PUBMED:11715049) ]. Elf-1 is an immune cell specific transcription factor. It is found in T cells, B cells, megakaryocytes,and mast cells and is involved in the control of transcription for various immune proteins [ (PUBMED:11210123) ]. Included in the Elf subfamily are also Elf-2 (NERF) [ (PUBMED:8756667) ] and Elf4 (MEF) [ (PUBMED:19412182) ].

This entry represents a domain found in the N terminus of Elf transcription factors. It is approximately 110 amino acids in length and is found in association with . It contains a conserved PAVIVE sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Elf-1_N