The domain within your query sequence starts at position 38 and ends at position 149; the E-value for the EmrE domain shown below is 3.9e-9.
VWRRTQTGDIHLCLNFGFHPVCDQCYVCQDLVDRTRTWLYAACSVSYVGAMVSSNSALQF VNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPK
EmrE |
 |
|---|
| PFAM accession number: | PF13536 |
|---|---|
| Interpro abstract (IPR032713): | This is a membrane protein family whose members are purported to be related to the DMT or Drug/Metabolite Transporter (DMT) Superfamily. Members are all uncharacterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry EmrE