SMART: Pfam domain Enamelin

The domain within your query sequence starts at position 216 and ends at position 441; the E-value for the Enamelin domain shown below is 5.4e-74.

PYYSEEMFEDYEKPKEKDPPKPEDPPPDDPPPEASTNSTVPDANATQSIPEGGNDTSPIG
NTGPGPNAGNNPTVQNGVFPPPKVNVSGQGVPKSQIPWRPSQPNIYENYPYPNYPSERQW
QTTGTQGPRQNGPGYRNPQVERGPQWNSFAWEGKQATRPGNPTYGKPPSPTSGVNYAGNP
VHFGRNLPGPNKPFVGANPASNKPFVGANPASNKPFVGANPASNKP

Enamelin

PFAM accession number:	PF15362
Interpro abstract (IPR015673):	Enamelin is a secreted structural protein that acts to create dental enamel matrix. Enamelin protein is proteolytically cleaved into several products, which are identified by their molecular weights and appear to have different functions in different enamel compartments. It is not currently known how enamelin interacts with other proteins of the enamel matrix [ (PUBMED:14656895) ]. Enamelin mutations have been found to cause certain forms of amelogenesis imperfecta, a condition in which enamel is malformed [ (PUBMED:11037750) ].

PFAM accession number:

PF15362

Interpro abstract (IPR015673):

Enamelin is a secreted structural protein that acts to create dental enamel matrix. Enamelin protein is proteolytically cleaved into several products, which are identified by their molecular weights and appear to have different functions in different enamel compartments. It is not currently known how enamelin interacts with other proteins of the enamel matrix [ (PUBMED:14656895) ].

Enamelin mutations have been found to cause certain forms of amelogenesis imperfecta, a condition in which enamel is malformed [ (PUBMED:11037750) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Enamelin