The domain within your query sequence starts at position 24 and ends at position 248; the E-value for the Epimerase domain shown below is 3.8e-23.
VQEKELQEVRALDKVFRPETKEEFSKLQTKTKVTVLEGDILDAQCLRRACQGISVVIHTA AVIDVTGVIPRQTILDVNLKGTQNLLEACVQASVPAFIFCSSVDVAGPNSYKKIVLNGHE EQNHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLNTCALRPMYIYGERSPFIFNAII RALKNKGILCVTGKFSIANPVYVENVAWAHILAARGLRDPKKSTS
Epimerase |
![]() |
---|
PFAM accession number: | PF01370 |
---|---|
Interpro abstract (IPR001509): | This domain is found in proteins that utilise NAD as a cofactor and use nucleotide-sugar substrates for a variety of chemical reactions [ (PUBMED:9174344) ]. One of the best studied of these proteins is UDP-galactose 4-epimerase which catalyses the conversion of UDP-galactose to UDP-glucose during galactose metabolism [ (PUBMED:11279032) (PUBMED:10801319) ]. |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Epimerase