The domain within your query sequence starts at position 32 and ends at position 292; the E-value for the Epimerase_2 domain shown below is 2.5e-54.

IKTEPAFFELDVVVLGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVGLA
LVKLPDVLNRLKPDIMIVHGDRFDALALATSAALMNIRILHIEGGEVSGTIDDSIRHAIT
KLAHYHVCCTRSAEQHLISMCEDHDRILLAGCPSYDKLLSAKNKDYMSIIRMWLGDDVKC
KDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKEMVRVMRKKGIE
HHPNFRAVKHVPFDQFIQLVA

Epimerase_2

Epimerase_2
PFAM accession number:PF02350
Interpro abstract (IPR003331):

This entry represents a domain found in the bacterial UDP-N-acetylglucosamine 2-epimerase WecB, which is involved in the enterobacterial common antigen biosynthesis [ (PUBMED:2166030) ]. It can also be found in the N-terminal region of the mammalian bifunctional protein GNE, which has both the UDP-N-acetylglucosamine 2-epimerase and the N-acetylmannosamine kinase functions. GNE catalyses the first two steps of sialic acid biosynthesis in the cytosol [ (PUBMED:11929971) ].

Proteins containing this domain also include UDP-N,N'-diacetylbacillosamine 2-epimerase, which is involved in biosynthesis of legionaminic acid (5,7-diamino-3,5,7,9-tetradeoxy-D-glycero-D-galacto-non-2-ulosonic acid)(Leg), a sialic acid-like derivative that is incorporated into virulence-associated cell surface glycoconjugates such as lipopolysaccharide (LPS) which could be a key determinant in the ability of L. pneumophila to inhibit the fusion of phagosomes with lysosomes [ (PUBMED:18275154) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Epimerase_2