The domain within your query sequence starts at position 1 and ends at position 186; the E-value for the Erv26 domain shown below is 6.2e-58.
MWFMYVLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLY VFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYY PFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVV FSFIKE
Erv26 |
---|
PFAM accession number: | PF04148 |
---|---|
Interpro abstract (IPR007277): | This entry includes Svp26 from yeasts and Tex261 from animals. Budding yeast Svp26 is a integral membrane protein found in the ER and early Golgi compartment [ (PUBMED:20236934) ]. It functions as an ER exit adaptor protein of mannosyltransferases Mnt2 and Mnt3 [ (PUBMED:30700649) ]. The function of Tex261 is not clear. |
GO process: | endoplasmic reticulum to Golgi vesicle-mediated transport (GO:0006888) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | COPII adaptor activity (GO:0097020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Erv26