The domain within your query sequence starts at position 23 and ends at position 242; the E-value for the Esterase domain shown below is 1.3e-57.
SVELKCKMRFAVYLPPQAESGKCPALYWLSGLTCTEQNFISKSGYQQAASEHGLVVIAPD TSPRGCNIKGEDDSWDFGTGAGFYVNATEDPWKANYRMYSYVTEELPQLINANFPVDPQR MSIFGHSMGGHGALICALKNPGKYRAYDATCLVKAYSGSQIDILIDQGKDDEFLSNGQLL PDNFIAACTEKKIPVVFRLQEGYDHSYYFIATFIADHIRH
Esterase |
---|
PFAM accession number: | PF00756 |
---|---|
Interpro abstract (IPR000801): | This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Esterase