SMART: Pfam domain Exo84

The domain within your query sequence starts at position 326 and ends at position 531; the E-value for the Exo84_C domain shown below is 6.8e-59.

EWIQELPEDLDVCIAQRDFEGAVDLLDKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVL
VFELSPDRSLRGGPKATRRAVSQLIRLGQCTKACELFLRNRAAAVHTAIRQLRIEGATLL
YIHKLCHVFFTSLLETAREFETDFAGTDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKES
LSTAAECVKVAKEHCQQLGEIGLDLT

Exo84_C

PFAM accession number:	PF16528
Interpro abstract (IPR032403):	This entry represents the C-terminal helical region of the exocyst component Exo84. This region resembles a cullin-repeat, a multi-helical bundle. The exocyst is a large complex that is required for tethering vesicles at the final stages of the exocytic pathway in all eukaryotes. Exocyst subunits are composed of mostly helical modules strung together into long rods [ (PUBMED:16249794) ].

PFAM accession number:

PF16528

Interpro abstract (IPR032403):

This entry represents the C-terminal helical region of the exocyst component Exo84. This region resembles a cullin-repeat, a multi-helical bundle.

The exocyst is a large complex that is required for tethering vesicles at the final stages of the exocytic pathway in all eukaryotes. Exocyst subunits are composed of mostly helical modules strung together into long rods [ (PUBMED:16249794) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Exo84_C