The domain within your query sequence starts at position 289 and ends at position 530; the E-value for the FAD-oxidase_C domain shown below is 7.3e-58.
RPKAVNVAFLGCPGFAEVLQTFRTCRGMLGEILSAFEFMDTECMQLVGQHLQLTNPVQES PFYVLVETSGSSAGHDAEKLTNVLEQVLNSGLVTDGTMATDQRKVQMLWALRERITEALS RDGYVFKYDLSLPVERLYDLVIDLRTRLGPRAKHVVGYGHLGDGNLHLNVTAEAFSRELL GALEPYVYAWTAEQRGSVSAEHGLGFKKKDVLGYSKPPVAVTLMQQLKAMLDPEGILNPY KT
FAD-oxidase_C |
---|
PFAM accession number: | PF02913 |
---|---|
Interpro abstract (IPR004113): | Some oxygen-dependent oxidoreductases are flavoproteins that contain a covalently bound FAD group which is attached to a histidine via an 8-alpha-(N3-histidyl)-riboflavin linkage. The region around the histidine that binds the FAD group is conserved in these enzymes (see IPR006093 ). |
GO function: | catalytic activity (GO:0003824), flavin adenine dinucleotide binding (GO:0050660) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAD-oxidase_C