The domain within your query sequence starts at position 2 and ends at position 104; the E-value for the FAM110_N domain shown below is 3.9e-41.
PVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEADKAKYVKSLRVAN TRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDL
FAM110_N |
---|
PFAM accession number: | PF14161 |
---|---|
Interpro abstract (IPR025739): | This entry represents the N terminus of a family of proteins that colocalise with the centrosome/microtubule organisation centre in interphase and at the spindle poles in mitosis [ (PUBMED:17499476) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM110_N