SMART: Pfam domain FAM178

The domain within your query sequence starts at position 86 and ends at position 385; the E-value for the FAM178 domain shown below is 1e-130.

YLLQEKRMLVEKFSVSLQVISPVHPGETVFLPRRHPLPCFLDSSRLKPHSPLEELFLRSS
LPEQLSFLHNGLLSNLYLHAADCPQPLLQWLFQLLTWPPETSSRAFGLLWDLSIDGLFRQ
PDEDMHFWCPSLQEVKEVFSSLGAYNPALYPQGPFQHSARVLESEASLDSQDPPQEVALD
IKLNYIYKFLTLCLLVRPVSYTDASILDLMELLCRAGLDVGLCLLPKTDLQQLLLLLLER
IQEWPGKLQPLCCALSWVSDHHHNLLALVQFFLDVTPRGRQLRSQLSLVIIARMLGQQES

FAM178

PFAM accession number:	PF14816
Interpro abstract (IPR026161):	This entry represents the FAM178 family, whose members are metazoan proteins and include FAM178A and FAM178B. The human FAM178A protein has been shown to be widely expressed [ (PUBMED:12459258) ] and is phosphorylated upon DNA damage, probably by ATM (ataxia telangiectasia mutated) or ATR (ATM and Rad3-related) [ (PUBMED:17081983) (PUBMED:17525332) ]. FAM178A, also known as SLF2 (SMC5-SMC6 complex localization factor 2), forms a complex with RAD18 and SLF1, and together they define a pathway that suppresses genome instability by recruiting the SMC5/6 cohesion complex to DNA lesions [ (PUBMED:25931565) ].

PFAM accession number:

PF14816

Interpro abstract (IPR026161):

This entry represents the FAM178 family, whose members are metazoan proteins and include FAM178A and FAM178B. The human FAM178A protein has been shown to be widely expressed [ (PUBMED:12459258) ] and is phosphorylated upon DNA damage, probably by ATM (ataxia telangiectasia mutated) or ATR (ATM and Rad3-related) [ (PUBMED:17081983) (PUBMED:17525332) ].

FAM178A, also known as SLF2 (SMC5-SMC6 complex localization factor 2), forms a complex with RAD18 and SLF1, and together they define a pathway that suppresses genome instability by recruiting the SMC5/6 cohesion complex to DNA lesions [ (PUBMED:25931565) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM178