The domain within your query sequence starts at position 21 and ends at position 168; the E-value for the FAM209 domain shown below is 9.1e-78.
FMFSSMREKTKESPGKVPCGGHFRIRQNLPENAQGWLGNKWLWLFVAIMIYVMLKFRGDG ENKEQHPPGLRGCQLRSPPKKAQNISPSKDFTFNTLTQLEMELVKFVSKVRNLKVSMATN SNSRQQVPESPTNLYNNVTIYEIWGEED
FAM209 |
---|
PFAM accession number: | PF15206 |
---|---|
Interpro abstract (IPR027943): | This family of proteins is found in eukaryotes. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM209