The domain within your query sequence starts at position 146 and ends at position 201; the E-value for the FAM212 domain shown below is 1.7e-30.

PRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPEA

FAM212

 FAM212
PFAM accession number:PF15342
Interpro abstract (IPR029267):

This entry represents a domain found in the Inka proteins, including Inka1 and Inka2. They are inhibitors of PAK4, a metazoan-specific kinase acting downstream of Cdc42 [ (PUBMED:26607847) (PUBMED:26607847) ]. Danio rerio (Zebrafish) Inka1 is required for the proper migration of neural crest cells during embryonic development [ (PUBMED:17314132) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM212