The domain within your query sequence starts at position 50 and ends at position 160; the E-value for the FAM216B domain shown below is 6e-49.
VYAHIAKLQELWKTTQIQTIHIPKSMTDASFLKHPELTLGQKRYLCSVAKICNSSYLRTL MKRQYMHIFHHGSQKTGVLTHHRGHMSSRYSQKQHSPCTAWRHHLEREDSL
FAM216B |
![]() |
---|
PFAM accession number: | PF15107 |
---|---|
Interpro abstract (IPR029373): | This entry represents a group of eukaryotic proteins, FAM216. They are approximately 150 - 270 amino acids in length. In humans, the gene encoding FAM216B protein is located in the position, C13orf30. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM216B