The domain within your query sequence starts at position 72 and ends at position 128; the E-value for the FAM219A domain shown below is 4.2e-18.

KKHRDHAKAVLRRKGMLGALTNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSR

FAM219A

FAM219A
PFAM accession number:PF15260
Interpro abstract (IPR029339):

This entry represents a group of eukaryotic proteins that are typically between 144 and 191 amino acids in length. There are two conserved sequence motifs: QLL and LDE.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM219A