The domain within your query sequence starts at position 2 and ends at position 95; the E-value for the FAM60A domain shown below is 6.3e-61.
FGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVK RWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKK
FAM60A |
![]() |
---|
PFAM accession number: | PF15396 |
---|---|
Interpro abstract (IPR026065): | SIN3-HDAC complex-associated factor (also known as FAM60A) is found in eukaryotes. It has been shown to be a subunit of the Sin3 deacetylase complex (Sin3/HDAC), important for the repression of genes involved in the TGF-beta signaling pathway [ (PUBMED:22984288) ],[ (PUBMED:22865885) ]. Human FAM60A protein has been shown to be up-regulated in squamous cell carcinoma (SCC), adenocarcinoma (AC), colon, ovary, rectum and stomach tumors. Human FAM60A is phosphorylated upon DNA damage, probably by ATM or ATR [ (PUBMED:17525332) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM60A