The domain within your query sequence starts at position 453 and ends at position 628; the E-value for the FAM75 domain shown below is 1.2e-12.
PPYKEPHFLKVSPPIPLPEAAPPPSSTSPNESLDEPQRAQIGGVPFLTLSECKTLEWHLL QRQLQLQWGLSAVIARPPRVQSHTQYKHKPWNKAKPRETLKFFGPGKPFSAFTRELFFIP QHARKLLEFHLQKRLIHLRWGLPQRIQRSINMLLSSTDPQSLPCGGSRLPNVSISQ
FAM75 |
---|
PFAM accession number: | PF14650 |
---|---|
Interpro abstract (IPR039509): | This entry represents a domain found in SPATA31 and FAM205 proteins. Their function is not clear. SPATA31 (spermatogenesis-associated protein 31), also known as Aep1, plays a role in spermatogenesis [ (PUBMED:16924657) ]. Aep1 has been found to interact with beta-actin and syntaxin 1 in vitro [ (PUBMED:20850414) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAM75