SMART: Pfam domain FANCI

The domain within your query sequence starts at position 775 and ends at position 850; the E-value for the FANCI_S3 domain shown below is 1.3e-30.

LLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHYAVNVTLQKIQQLIRTGHVSGPD
GQNPDKIFQNLCDITR

FANCI_S3

PFAM accession number:	PF14677
Interpro abstract (IPR029313):	FANCI and FANCD2 form a complex central to the Fanconi anemia (FA) pathway, which is essential for the repair of DNA interstrand cross-links. FANCI has four distinct alpha solenoid (alpha-alpha superhelical) segments (S1-S4). Two mostly helical segments intervene between solenoids 1 and 2 (HD1), and between solenoids 2 and 3 (HD2) [ (PUBMED:21764741) ]. This is the solenoid 3 (S3) domain of the Fanconi anemia group I protein (FANCI).

PFAM accession number:

PF14677

Interpro abstract (IPR029313):

FANCI and FANCD2 form a complex central to the Fanconi anemia (FA) pathway, which is essential for the repair of DNA interstrand cross-links. FANCI has four distinct alpha solenoid (alpha-alpha superhelical) segments (S1-S4). Two mostly helical segments intervene between solenoids 1 and 2 (HD1), and between solenoids 2 and 3 (HD2) [ (PUBMED:21764741) ].

This is the solenoid 3 (S3) domain of the Fanconi anemia group I protein (FANCI).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FANCI_S3