The domain within your query sequence starts at position 349 and ends at position 440; the E-value for the FAST_2 domain shown below is 6.9e-26.
IVRRYLSLLDTAVELELPGYQGPRLPQRQRVPIFPQPLITDRARCKYSHKDMVAEGLRQL LGEENYRQNLTVPPGYCTDFLLCVSSSGAVLP
FAST_2 |
![]() |
---|
PFAM accession number: | PF08368 |
---|---|
Interpro abstract (IPR013579): | This domain represents a conserved region of eukaryotic Fas-activated serine/threonine (FAST) kinases ( EC 2.7.1 ) that contains several conserved leucine residues. FAST kinase is rapidly activated during Fas-mediated apoptosis, when it phosphorylates TIA-1, a nuclear RNA-binding protein that has been implicated as an effector of apoptosis [ (PUBMED:7544399) ]. Note that many family members are hypothetical proteins. This subdomain is often found associated with the FAST kinase-like protein, subdomain 2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FAST_2