The domain within your query sequence starts at position 11 and ends at position 62; the E-value for the FF domain shown below is 2.2e-7.
RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREF
FF |
![]() |
---|
PFAM accession number: | PF01846 |
---|---|
Interpro abstract (IPR002713): | The FF domain may be involved in protein-protein interaction [ (PUBMED:10390614) ]. It often occurs as multiple copies and often accompanies WW domains IPR001202 . PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [ (PUBMED:8622699) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FF