The domain within your query sequence starts at position 1 and ends at position 52; the E-value for the FHA domain shown below is 2.5e-13.
MISRSHCVLKQNPEGQWTIMDNKSLNGVWLNRERLAPLQGYCIRKGDHIQLG
FHA |
---|
PFAM accession number: | PF00498 |
---|---|
Interpro abstract (IPR000253): | The forkhead-associated (FHA) domain [ (PUBMED:7482699) ] is a phosphopeptide recognition domain found in many regulatory proteins. It displays specificity for phosphothreonine-containing epitopes but will also recognise phosphotyrosine with relatively high affinity. It spans approximately 80-100 amino acid residues folded into an 11-stranded beta sandwich, which sometimes contain small helical insertions between the loops connecting the strands [ (PUBMED:11911881) ]. To date, genes encoding FHA-containing proteins have been identified in eubacterial and eukaryotic but not archaeal genomes. The domain is present in a diverse range of proteins, such as kinases, phosphatases, kinesins, transcription factors, RNA-binding proteins and metabolic enzymes which partake in many different cellular processes - DNA repair, signal transduction, vesicular transport and protein degradation are just a few examples. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FHA