SMART: Pfam domain FKBP

The domain within your query sequence starts at position 54 and ends at position 146; the E-value for the FKBP_C domain shown below is 1.4e-29.

CPREVQMGDFVRYHYNGTFEDGKKFDSSYDRSTLVAIVVGVGRLITGMDRGLMGMCVNER
RRLIVPPHLGYGSIGVAGLIPPDATLYFDVVLL

FKBP_C

PFAM accession number:	PF00254
Interpro abstract (IPR001179):	This entry represents a domain found in FKBP-type peptidylprolyl isomerases. FKBP-type peptidylprolyl isomerases ( EC 5.2.1.8 ) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms.
GO function:	peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

PFAM accession number:

PF00254

Interpro abstract (IPR001179):

This entry represents a domain found in FKBP-type peptidylprolyl isomerases.

FKBP-type peptidylprolyl isomerases ( EC 5.2.1.8 ) in vertebrates, are receptors for the two immunosuppressants, FK506 and rapamycin. The drugs inhibit T cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. Peptidylprolyl isomerases accelerate protein folding by catalysing the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides. These proteins are found in a variety of organisms.

GO function:

peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FKBP_C