The domain within your query sequence starts at position 431 and ends at position 510; the E-value for the FOXO_KIX_bdg domain shown below is 5.5e-36.
STVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSHSDVMMTQSDP LMSQASTAVSAQNARRNVML
FOXO_KIX_bdg |
 |
|---|
| PFAM accession number: | PF16675 |
|---|---|
| Interpro abstract (IPR032068): | This entry represents a domain found in the transcription factor forkhead box O (FOXO) that binds to the KIX domain of CREB-binding proteins. Coactivator CBP/p300 is recruited by FOXO3 via the binding of this domain as well as the simultaneous binding of the C-terminal TAD domain [ (PUBMED:22474372) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FOXO_KIX_bdg