The domain within your query sequence starts at position 81 and ends at position 183; the E-value for the FUN14 domain shown below is 2.9e-35.
QLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWSRVEKDMKKAKEQ LTIRKSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLLGMA
FUN14 |
 |
|---|
| PFAM accession number: | PF04930 |
|---|---|
| Interpro abstract (IPR007014): | This is a family of short proteins found in eukaryotes and some archaea. In humans, FUN14 domain-containing protein 1 (FUND1) acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control [ (PUBMED:22267086) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FUN14