The domain within your query sequence starts at position 5 and ends at position 59; the E-value for the FYVE_2 domain shown below is 5.5e-9.

SFLTEEEQDAILKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKA

FYVE_2

FYVE_2
PFAM accession number:PF02318
Interpro abstract (IPR041282):

This FYVE-type zinc finger is found at the N terminus of effector proteins including rabphilin-3A [ (PUBMED:10025402) ] and regulating synaptic membrane exocytosis protein 2 [ (PUBMED:16732694) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FYVE_2