The domain within your query sequence starts at position 306 and ends at position 522; the E-value for the Fam20C domain shown below is 8.9e-101.
FVSPANNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLAPRLSVPNPWIRSYSL SGKEEWELNPLYCDTVKQIYPYNSSNRLLGIIDMAVFDFLIGNMDRHHYEMFTKFGDDGY LIHLDNARGFGRHSQDEISILAPLAQCCMIKRKTLLHLQLLAQADYRLSDVMRESLLEDQ LSPVLTEPHLLALDRRLQIILKTVEDCIEAHGERRVI
Fam20C |
![]() |
---|
PFAM accession number: | PF06702 |
---|---|
Interpro abstract (IPR009581): | This entry represents the C-terminal of the eukaryotic secreted Golgi casein kinase protein FAM20C. FAM20C is the Golgi casein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs. Mutations in the FAM20C gene cause Raine syndrome, an autosomal recessive osteosclerotic bone dysplasia [ (PUBMED:23754375) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fam20C